PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta006882
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LFY
Protein Properties Length: 412aa    MW: 47379.5 Da    PI: 6.9903
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-32701PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY528.23.3e-161284121368
    FLO_LFY   1 mdpeafsaslfkwdpraaa.....aapparlleeaavseapleaaaaaaark.lreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmksls 94 
                md+e+f++ +f+wd+r+aa     aap++++++++  + +ple+   ++ rk l++le+lfk+yGvry+t+ak++e+Gft++tLv+m++ee++dlmk+l+
  Pta006882  28 MDAEHFPVGFFRWDQRPAAvvaaaAAPTTTVFNKD--HGRPLEVILPMNGRKdLKSLEDLFKEYGVRYVTLAKMTEMGFTANTLVNMTEEEIEDLMKTLV 125
                9*************877764443233334555444..4566788899999888*********************************************** PP

    FLO_LFY  95 eifrldllvGeryGikaavraerrrlee..........eeaekkrrkllsedeetaldalsqeglseepvqe..eke.aagsggeglgeaelvaaeekks 181
                e++++dll+GeryGik+a+rae++rl++          +e  ++r+++l++d++t   a+++eg+s+e +++   ++ +++s+++  ++ ++ + ++   
  Pta006882 126 ELYHMDLLIGERYGIKSAIRAEKKRLQDslemqrleilSE--AERKRILHDDQNTFAAAMASEGTSKELRANdpLIFpESTSADHAPMNIASCKDSTLIL 223
                ****************************999999987544..55555799**9***************99985533345555444434433333333333 PP

    FLO_LFY 182 eeekkkaskkkqkrk..kkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPt 279
                +++++ +          ++++++ e++ d+++++ + +++ gedge+r+rehPfivtepge+argkknGLDYLfdLyeqC++fLl+vq+iake+GekcPt
  Pta006882 224 QNSNQAQFCGSGLIGvpEHSSESDERKADTNKQKRRRSKEPGEDGEDRPREHPFIVTEPGELARGKKNGLDYLFDLYEQCGKFLLEVQRIAKEKGEKCPT 323
                33333332222222200222222334455566666677789*********************************************************** PP

    FLO_LFY 280 kvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiW 368
                kvtnqvfr+ak++ga+yinkPkmrhYvhCYalhcLd+e+sn+lrr +kergenvGawrqacy+plvaia++++wdi+++fn++++L+iW
  Pta006882 324 KVTNQVFRHAKHNGAVYINKPKMRHYVHCYALHCLDSEQSNHLRRLYKERGENVGAWRQACYYPLVAIARENNWDIEGIFNRNEKLKIW 412
                ***************************************************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.4E-13028412IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
XKSWMVERSL GLEVFSEERT AFYLEKNMDA EHFPVGFFRW DQRPAAVVAA AAAPTTTVFN  60
KDHGRPLEVI LPMNGRKDLK SLEDLFKEYG VRYVTLAKMT EMGFTANTLV NMTEEEIEDL  120
MKTLVELYHM DLLIGERYGI KSAIRAEKKR LQDSLEMQRL EILSEAERKR ILHDDQNTFA  180
AAMASEGTSK ELRANDPLIF PESTSADHAP MNIASCKDST LILQNSNQAQ FCGSGLIGVP  240
EHSSESDERK ADTNKQKRRR SKEPGEDGED RPREHPFIVT EPGELARGKK NGLDYLFDLY  300
EQCGKFLLEV QRIAKEKGEK CPTKVTNQVF RHAKHNGAVY INKPKMRHYV HCYALHCLDS  360
EQSNHLRRLY KERGENVGAW RQACYYPLVA IARENNWDIE GIFNRNEKLK IW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A1e-872634124153FLORICAULA/LEAFY HOMOLOG 1
4bhk_B1e-872634124153FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.101520.0needle| root| shoot| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002978027.11e-132hypothetical protein SELMODRAFT_417910
SwissprotO044070.0NEED_PINRA; Floricaula/leafy-like protein FL1
TrEMBLA0A0K0M7300.0A0A0K0M730_PINTB; NEEDLY
STRINGEFJ206841e-131(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-78floral meristem identity control protein LEAFY (LFY)